Plant Lolium perenne Pollen allergen Lol p 1 protein

Product Overview

• Article Name: Plant Lolium perenne Pollen allergen Lol p 1 protein
• Biozol Catalog Number: BYT-ORB604588
• Supplier Catalog Number: orb604588
• Alternative Catalog Number: BYT-ORB604588-20,BYT-ORB604588-100,BYT-ORB604588-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Allergen Lol p I (Allergen R7) (Allergen, Lol p 1)

Product Description

This Plant Lolium perenne Pollen allergen Lol p 1 protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 31.2 kDa
• UniProt: P14946
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Lolium perenne (Perennial ryegrass)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK

Application Notes

• Application Notes: Biological Origin: Lolium perenne (Perennial ryegrass). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lolium perenne (Perennial ryegrass).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lolium perenne (Perennial ryegrass).