Bacteria acm protein

Product Overview

• Article Name: Bacteria acm protein
• Biozol Catalog Number: BYT-ORB604617
• Supplier Catalog Number: orb604617
• Alternative Catalog Number: BYT-ORB604617-20,BYT-ORB604617-100,BYT-ORB604617-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 1,4-beta-N-acetylmuramidase M1

Product Description

This Bacteria acm protein spans the amino acid sequence from region 78-294aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 30.6 kDa
• UniProt: P25310
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Streptomyces globisporus
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA

Application Notes

• Application Notes: Biological Origin: Streptomyces globisporus. Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces globisporusacm.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces globisporusacm.