Bacteria porB protein

Catalog Number: BYT-ORB604618
Article Name: Bacteria porB protein
Biozol Catalog Number: BYT-ORB604618
Supplier Catalog Number: orb604618
Alternative Catalog Number: BYT-ORB604618-20,BYT-ORB604618-100,BYT-ORB604618-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Class 3 protein Porin
This Bacteria porB protein spans the amino acid sequence from region 20-331aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 37.9 kDa
UniProt: P30689
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Neisseria meningitidis serogroup B
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHRVQEDINIEKYQIHRLVSGYDNDALHASVAVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTPRVSYAHGFRG
Application Notes: Biological Origin: Neisseria meningitidis serogroup B. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup BporB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup BporB.