Human HLA-A protein

Product Overview

• Article Name: Human HLA-A protein
• Biozol Catalog Number: BYT-ORB604627
• Supplier Catalog Number: orb604627
• Alternative Catalog Number: BYT-ORB604627-20,BYT-ORB604627-100,BYT-ORB604627-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MHC class I antigen A*1 HLAA

Product Description

This Human HLA-A protein spans the amino acid sequence from region 25-308aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.7 kDa
• UniProt: P30443
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQ

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.