Plant WAXY protein

Product Overview

• Article Name: Plant WAXY protein
• Biozol Catalog Number: BYT-ORB604645
• Supplier Catalog Number: orb604645
• Alternative Catalog Number: BYT-ORB604645-20,BYT-ORB604645-100,BYT-ORB604645-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Granule-bound starch synthase I Short name, GBSS-I

Product Description

This Plant WAXY protein spans the amino acid sequence from region 79-349aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.8 kDa
• UniProt: P27736
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Triticum aestivum (Wheat)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEE

Application Notes

• Application Notes: Biological Origin: Triticum aestivum (Wheat). Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Triticum aestivum (Wheat) WAXY.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Triticum aestivum (Wheat) WAXY.