Virus APE3 protein

Product Overview

• Article Name: Virus APE3 protein
• Biozol Catalog Number: BYT-ORB604672
• Supplier Catalog Number: orb604672
• Alternative Catalog Number: BYT-ORB604672-20,BYT-ORB604672-100,BYT-ORB604672-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: APE3, YBR286W, YBR2024Aminopeptidase Y, EC 3.4.11.15

Product Description

This Virus APE3 protein spans the amino acid sequence from region 57-537aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 58.9 kDa
• UniProt: P37302
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IPKPHIPYFMKPHVESEKLQDKIKVDDLNATAWDLYRLANYSTPDYGHPTRVIGSKGHNKTMEYILNVFDDMQDYYDVSLQEFEALSGKIISFNLSDAETGKSFANTTAFALSPPVDGFVGKLVEIPNLGCEEKDYASVVPPRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNEPKSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNIDYSLYFAMDSYVEFIKTQNIIADTKHGDPDNIVAL

Application Notes

• Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) APE3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) APE3.