Bacteria MAP_1030 protein

Product Overview

• Article Name: Bacteria MAP_1030 protein
• Biozol Catalog Number: BYT-ORB604708
• Supplier Catalog Number: orb604708
• Alternative Catalog Number: BYT-ORB604708-20,BYT-ORB604708-100,BYT-ORB604708-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MAP_1030, Probable transcriptional regulatory protein MAP_1030

Product Description

This Bacteria MAP_1030 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.8 kDa
• UniProt: P62039
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Application Notes

• Application Notes: Biological Origin: Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) MAP_1030.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) MAP_1030.