Virus F protein

Catalog Number: BYT-ORB604715
Article Name: Virus F protein
Biozol Catalog Number: BYT-ORB604715
Supplier Catalog Number: orb604715
Alternative Catalog Number: BYT-ORB604715-20,BYT-ORB604715-100,BYT-ORB604715-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein F
This Virus F protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 58.9 kDa
UniProt: P03420
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Human respiratory syncytial virus A (strain A2)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIV
Application Notes: Biological Origin: Human respiratory syncytial virus A (strain A2). Application Notes: Extracellular Domain
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human respiratory syncytial virus A (strain A2) F.