E. coli ompC protein
Catalog Number:
BYT-ORB604724
- Images (3)
| Article Name: | E. coli ompC protein |
| Biozol Catalog Number: | BYT-ORB604724 |
| Supplier Catalog Number: | orb604724 |
| Alternative Catalog Number: | BYT-ORB604724-20,BYT-ORB604724-100,BYT-ORB604724-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Outer membrane protein 1BPorin OmpC |
| This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 38.3 kDa |
| UniProt: | P06996 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Escherichia coli (strain K12) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANK |
| Application Notes: | Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein |



