Rat Mcpt1 protein

Catalog Number: BYT-ORB604732
Article Name: Rat Mcpt1 protein
Biozol Catalog Number: BYT-ORB604732
Supplier Catalog Number: orb604732
Alternative Catalog Number: BYT-ORB604732-20,BYT-ORB604732-100,BYT-ORB604732-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)
This Rat Mcpt1 protein spans the amino acid sequence from region 21-260aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 28.6 kDa
UniProt: P09650
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Mcpt1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Mcpt1.