Bacteria bla protein

Catalog Number: BYT-ORB604739
Article Name: Bacteria bla protein
Biozol Catalog Number: BYT-ORB604739
Supplier Catalog Number: orb604739
Alternative Catalog Number: BYT-ORB604739-20,BYT-ORB604739-100,BYT-ORB604739-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: shv5
This Bacteria bla protein spans the amino acid sequence from region 22-286aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.3 kDa
UniProt: P0A3M1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Klebsiella pneumoniae
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGI
Application Notes: Biological Origin: Klebsiella pneumoniae. Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaebla.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaebla.