E. coli malE protein

Product Overview

• Article Name: E. coli malE protein
• Biozol Catalog Number: BYT-ORB604754
• Supplier Catalog Number: orb604754
• Alternative Catalog Number: BYT-ORB604754-20,BYT-ORB604754-100,BYT-ORB604754-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MMBP (Maltodextrin-binding protein) (Maltose-binding protein) (MBP)

Product Description

This E. coli malE protein spans the amino acid sequence from region 27-396aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 48.2 kDa
• UniProt: P0AEX9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli (strain K12)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPS

Application Notes

• Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) malE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) malE.