E. coli mscL protein

Catalog Number: BYT-ORB604792
Article Name: E. coli mscL protein
Biozol Catalog Number: BYT-ORB604792
Supplier Catalog Number: orb604792
Alternative Catalog Number: BYT-ORB604792-20,BYT-ORB604792-100,BYT-ORB604792-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: mscL, Z4661, ECs4156, Large-conductance mechanosensitive channel
This E. coli mscL protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 29 kDa
UniProt: P0A743
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli O157:H7
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Application Notes: Biological Origin: Escherichia coli O157:H7. Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7mscL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O157: H7mscL.