Virus Yellow fever virus Genome polyprotein protein

Product Overview

• Article Name: Virus Yellow fever virus Genome polyprotein protein
• Biozol Catalog Number: BYT-ORB604816
• Supplier Catalog Number: orb604816
• Alternative Catalog Number: BYT-ORB604816-20,BYT-ORB604816-100,BYT-ORB604816-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Core protein Matrix protein NS2A NS1 NS2A-alpha Flavivirin protease NS2B regulatory subunit Non-structural protein 2B Flavivirin protease NS3 catalytic subunit Non-structural protein 3 NS4A NS4B Non-structural protein 5

Product Description

This Virus Yellow fever virus Genome polyprotein protein spans the amino acid sequence from region 286-730aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 78.4 kDa
• UniProt: P03314
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yellow fever virus (strain 17D vaccine) (YFV)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AHCIGITDRDFIEGVHGGTWVSATLEQDKCVTVMAPDKPSLDISLETVAIDRPAEVRKVCYNAVLTHVKINDKCPSTGEAHLAEENEGDNACKRTYSDRGWGNGCGLFGKGSIVACAKFTCAKSMSLFEVDQTKIQYVIRAQLHVGAKQENWNTDIKTLKFDALSGSQEVEFIGYGKATLECQVQTAVDFGNSYIAEMETESWIVDRQWAQDLTLPWQSGSGGVWREMHHLVEFEPPHAATIRVLALGNQEGSLK

Application Notes

• Application Notes: Biological Origin: Yellow fever virus (strain 17D vaccine) (YFV). Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yellow fever virus (strain 17D vaccine) (YFV).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Yellow fever virus (strain 17D vaccine) (YFV).