Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein

Product Overview

• Article Name: Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein
• Biozol Catalog Number: BYT-ORB604851
• Supplier Catalog Number: orb604851
• Alternative Catalog Number: BYT-ORB604851-20,BYT-ORB604851-100,BYT-ORB604851-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Fetidin (Hemolysin) (Lysenin-3) (efL3) (LRP-2)

Product Description

This Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein spans the amino acid sequence from region 1-300aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 41.6 kDa
• UniProt: O18425
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Eisenia fetida (Red wiggler worm)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSSRAGIAEGYEQIEVDVVAVWKEGYVYENRGSTSVEQKIKITKGMRNLNSETKTLTASHSIGSTISTGDLFEIATVDVSYSYSHEESQVSMTETEVYESKEIEHTITIPPTSKFTRWQLNADVGGADIEYMYLIDEVTPIGGTLSIPQVIKSRAKILVGREIYLGETEIRIKHADRKEYMTVVSRKSWPAATLGHSKLYKFVLYEDMYGFRIKTLNTMYSGYEYAYSSDQGGIYFDQGSDNPKQRWAINKSLPL

Application Notes

• Application Notes: Biological Origin: Eisenia fetida (Red wiggler worm). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Eisenia fetida (Red wiggler worm).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Eisenia fetida (Red wiggler worm).