Human PODXL protein

Product Overview

• Article Name: Human PODXL protein
• Biozol Catalog Number: BYT-ORB604852
• Supplier Catalog Number: orb604852
• Alternative Catalog Number: BYT-ORB604852-20,BYT-ORB604852-100,BYT-ORB604852-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: GCTM-2 antigen, Gp200Podocalyxin-like protein 1 , PC , PCLP-1

Product Description

This Human PODXL protein spans the amino acid sequence from region 32-458aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 48.2 kDa
• UniProt: O00592
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPAS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PODXL.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PODXL.