Virus Cap protein

Catalog Number: BYT-ORB604868
Article Name: Virus Cap protein
Biozol Catalog Number: BYT-ORB604868
Supplier Catalog Number: orb604868
Alternative Catalog Number: BYT-ORB604868-20,BYT-ORB604868-100,BYT-ORB604868-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cap, ORF2Capsid protein
This Virus Cap protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 47.9 kDa
UniProt: O56129
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Porcine circovirus 2 (PCV2)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP
Application Notes: Biological Origin: Porcine circovirus 2 (PCV2). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Porcine circovirus 2 (PCV2) Cap.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Porcine circovirus 2 (PCV2) Cap.