Bacteria btuD protein

Product Overview

• Article Name: Bacteria btuD protein
• Biozol Catalog Number: BYT-ORB604872
• Supplier Catalog Number: orb604872
• Alternative Catalog Number: BYT-ORB604872-20,BYT-ORB604872-100,BYT-ORB604872-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Vitamin B12-transporting ATPase

Product Description

This Bacteria btuD protein spans the amino acid sequence from region 1-398aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 40.5 kDa
• UniProt: B0R5G4
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLP

Application Notes

• Application Notes: Biological Origin: Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) btuD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) btuD.