Human AP1B1 protein

Product Overview

• Article Name: Human AP1B1 protein
• Biozol Catalog Number: BYT-ORB604879
• Supplier Catalog Number: orb604879
• Alternative Catalog Number: BYT-ORB604879-20,BYT-ORB604879-100,BYT-ORB604879-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Adaptor protein complex AP-1 subunit beta-1 (Adaptor-related protein complex 1 subunit beta-1) (Beta-1-adaptin) (Beta-adaptin 1) (Clathrin assembly protein complex 1 beta large chain) (Golgi adaptor HA1/AP1 adaptin beta subunit) (ADTB1) (BAM22) (CLAPB2)

Product Description

This Human AP1B1 protein spans the amino acid sequence from region 1-584aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 73.3 kDa
• UniProt: Q10567
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AP1B1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AP1B1.