Human KCNMA1 protein

Product Overview

• Article Name: Human KCNMA1 protein
• Biozol Catalog Number: BYT-ORB604887
• Supplier Catalog Number: orb604887
• Alternative Catalog Number: BYT-ORB604887-20,BYT-ORB604887-100,BYT-ORB604887-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)

Product Description

This Human KCNMA1 protein spans the amino acid sequence from region 411-560aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 20.0 kDa
• UniProt: Q12791
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.