Mouse Tet2 protein

Catalog Number: BYT-ORB604951
Article Name: Mouse Tet2 protein
Biozol Catalog Number: BYT-ORB604951
Supplier Catalog Number: orb604951
Alternative Catalog Number: BYT-ORB604951-20,BYT-ORB604951-100,BYT-ORB604951-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein Ayu17-449 (Kiaa1546)
This Mouse Tet2 protein spans the amino acid sequence from region 1810-1912aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 27.0 kDa
UniProt: Q4JK59
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tet2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tet2.