Mouse Versican protein

Product Overview

• Article Name: Mouse Versican protein
• Biozol Catalog Number: BYT-ORB604971
• Supplier Catalog Number: orb604971
• Alternative Catalog Number: BYT-ORB604971-20,BYT-ORB604971-100,BYT-ORB604971-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2)

Product Description

This Mouse Versican protein spans the amino acid sequence from region 24-146aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 20.9 kDa
• UniProt: Q62059
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.