Mouse Adipoq protein

Product Overview

• Article Name: Mouse Adipoq protein
• Biozol Catalog Number: BYT-ORB604974
• Supplier Catalog Number: orb604974
• Alternative Catalog Number: BYT-ORB604974-20,BYT-ORB604974-100,BYT-ORB604974-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 30KDA adipocyte complement-related protein, Adipocyte complement-related 30KDA protein , ACRP30Adipocyte, C1q and collagen domain-containing protein, Adipocyte-specific protein AdipoQ

Product Description

This Mouse Adipoq protein spans the amino acid sequence from region 18-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 28.9 kDa
• UniProt: Q60994
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adipoq.