Mouse Adamts13 protein

Catalog Number: BYT-ORB604991
Article Name: Mouse Adamts13 protein
Biozol Catalog Number: BYT-ORB604991
Supplier Catalog Number: orb604991
Alternative Catalog Number: BYT-ORB604991-20,BYT-ORB604991-100,BYT-ORB604991-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)
This Mouse Adamts13 protein spans the amino acid sequence from region 904-1137aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 32.7 kDa
UniProt: Q769J6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adamts13.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adamts13.