Bacteria isdA protein

Product Overview

• Article Name: Bacteria isdA protein
• Biozol Catalog Number: BYT-ORB605010
• Supplier Catalog Number: orb605010
• Alternative Catalog Number: BYT-ORB605010-20,BYT-ORB605010-100,BYT-ORB605010-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbA

Product Description

This Bacteria isdA protein spans the amino acid sequence from region 47-316aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.1 kDa
• UniProt: Q6GA85
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Staphylococcus aureus (strain MSSA476)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHN

Application Notes

• Application Notes: Biological Origin: Staphylococcus aureus (strain MSSA476). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MSSA476) isdA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain MSSA476) isdA.