Virus M protein

Catalog Number: BYT-ORB605029
Article Name: Virus M protein
Biozol Catalog Number: BYT-ORB605029
Supplier Catalog Number: orb605029
Alternative Catalog Number: BYT-ORB605029-20,BYT-ORB605029-100,BYT-ORB605029-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: M, Matrix protein
This Virus M protein spans the amino acid sequence from region 1-229aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 33.5 kDa
UniProt: Q8B0I2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKFFFTVKLTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWILDSVSHFK
Application Notes: Biological Origin: Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV) M.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Vesicular stomatitis Indiana virus (strain 98COE North America) (VSIV) M.