Human FAM217A protein

Catalog Number: BYT-ORB605036
Article Name: Human FAM217A protein
Biozol Catalog Number: BYT-ORB605036
Supplier Catalog Number: orb605036
Alternative Catalog Number: BYT-ORB605036-20,BYT-ORB605036-100,BYT-ORB605036-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C6orf146
This Human FAM217A protein spans the amino acid sequence from region 1-508aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 61.4 kDa
UniProt: Q8IXS0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGRRNENCANSLRVSNISQENLSHWNLDSEVPVSENKNLPAGRDGAAGGKINKNYLEIPVEQLMLEPNLSVHSQKSTQNSKQGIFQLWNCPLNEGSTIEKREFKKSSVETGFNVINHPIRVFTLNHPLTIASVDKQVGPYPGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKPETIKNVEEPFTEEPNEVFPYPDFLPPP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FAM217A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FAM217A.