Recombinant Aspergillus fumigatus Probable glycosidase crf1 (crf1), partial

Catalog Number: BYT-ORB605044
Article Name: Recombinant Aspergillus fumigatus Probable glycosidase crf1 (crf1), partial
Biozol Catalog Number: BYT-ORB605044
Supplier Catalog Number: orb605044
Alternative Catalog Number: BYT-ORB605044-20,BYT-ORB605044-100,BYT-ORB605044-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Crh-like protein 1 (Allergen, Asp f 9)
This Recombinant Aspergillus fumigatus Probable glycosidase crf1 (crf1), partial spans the amino acid sequence from region 42-233aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 28.1 kDa
UniProt: Q8J0P4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY
Application Notes: Biological Origin: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) crf1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) crf1.