Mouse Il31ra protein

Product Overview

• Article Name: Mouse Il31ra protein
• Biozol Catalog Number: BYT-ORB605045
• Supplier Catalog Number: orb605045
• Alternative Catalog Number: BYT-ORB605045-20,BYT-ORB605045-100,BYT-ORB605045-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr)

Product Description

This Mouse Il31ra protein spans the amino acid sequence from region 19-499aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 59.2 kDa
• UniProt: Q8K5B1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSVNPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSSHWTEVNFENCKQVCNLTGLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTMEEVPHVLDLWRILEPADMNGDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTNLTEINNITTQ

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Il31ra.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Il31ra.