Human VPS35 protein

Product Overview

• Article Name: Human VPS35 protein
• Biozol Catalog Number: BYT-ORB605061
• Supplier Catalog Number: orb605061
• Alternative Catalog Number: BYT-ORB605061-20,BYT-ORB605061-100,BYT-ORB605061-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Maternal-embryonic 3 Vesicle protein sorting 35 MEM3

Product Description

This Human VPS35 protein spans the amino acid sequence from region 1-796aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 96.7 kDa
• UniProt: Q96QK1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQIVLTGILEQVVNCRD

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) VPS35.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) VPS35.