Human TENT4B protein

Product Overview

• Article Name: Human TENT4B protein
• Biozol Catalog Number: BYT-ORB605068
• Supplier Catalog Number: orb605068
• Alternative Catalog Number: BYT-ORB605068-20,BYT-ORB605068-100,BYT-ORB605068-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: PAP-associated domain-containing protein 5 (Terminal nucleotidyltransferase 4B) (Terminal uridylyltransferase 3) (TUTase 3) (Topoisomerase-related function protein 4-2) (TRF4-2) (GLD4) (PAPD5) (TRF4-2)

Product Description

This Human TENT4B protein spans the amino acid sequence from region 1-572aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 67.3 kDa
• UniProt: Q8NDF8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TENT4B.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TENT4B.