Human RB1CC1 protein

Catalog Number: BYT-ORB605082
Article Name: Human RB1CC1 protein
Biozol Catalog Number: BYT-ORB605082
Supplier Catalog Number: orb605082
Alternative Catalog Number: BYT-ORB605082-20,BYT-ORB605082-100,BYT-ORB605082-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FAK family kinase-interacting protein of 200 kDa (FIP200) (KIAA0203) (RBICC)
This Human RB1CC1 protein spans the amino acid sequence from region 1241-1594aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 47.7 kDa
UniProt: Q8TDY2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RB1CC1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) RB1CC1.