Rat Sost protein

Catalog Number: BYT-ORB605090
Article Name: Rat Sost protein
Biozol Catalog Number: BYT-ORB605090
Supplier Catalog Number: orb605090
Alternative Catalog Number: BYT-ORB605090-20,BYT-ORB605090-100,BYT-ORB605090-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sost, Sclerostin
This Rat Sost protein spans the amino acid sequence from region 29-213aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.0 kDa
UniProt: Q99P67
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost.