Mouse C1qtnf3 protein

Product Overview

• Article Name: Mouse C1qtnf3 protein
• Biozol Catalog Number: BYT-ORB605136
• Supplier Catalog Number: orb605136
• Alternative Catalog Number: BYT-ORB605136-20,BYT-ORB605136-100,BYT-ORB605136-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: C1qtnf3, Cors26, Ctrp3, Complement C1q tumor necrosis factor-related protein 3, Collagenous repeat-containing sequence 26 kDa protein, CORS26, Secretory protein CORS26

Product Description

This Mouse C1qtnf3 protein spans the amino acid sequence from region 23-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 31.1 kDa
• UniProt: Q9ES30
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.

SDS-Page analysis of Mouse C1qtnf3 protein.

Mouse C1qtnf3 protein.

Mouse C1qtnf3 protein.