Bacteria nadA protein

Product Overview

• Article Name: Bacteria nadA protein
• Biozol Catalog Number: BYT-ORB605139
• Supplier Catalog Number: orb605139
• Alternative Catalog Number: BYT-ORB605139-20,BYT-ORB605139-100,BYT-ORB605139-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: nadA, NMB0394, Quinolinate synthase A, EC 2.5.1.72

Product Description

This Bacteria nadA protein spans the amino acid sequence from region 1-370aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.2 kDa
• UniProt: Q9K105
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Neisseria meningitidis serogroup B (strain MC58)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MQTAARRSFDYDMPLIQTPTSACQIRQAWAKVADTPDRETADRLKDEIKALLKEKNAVLVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEAGTLVVAGVRFMGESAKILCPEKTVLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIVSYLKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPEAVVLVHPESPQSVIELGDVV

Application Notes

• Application Notes: Biological Origin: Neisseria meningitidis serogroup B (strain MC58). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup B (strain MC58) nadA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup B (strain MC58) nadA.