Bacteria KMP-11 protein
Catalog Number:
BYT-ORB605143
- Images (3)
| Article Name: | Bacteria KMP-11 protein |
| Biozol Catalog Number: | BYT-ORB605143 |
| Supplier Catalog Number: | orb605143 |
| Alternative Catalog Number: | BYT-ORB605143-20,BYT-ORB605143-100,BYT-ORB605143-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | KMP11 |
| This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 18.0 kDa |
| UniProt: | Q9U6Z1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Trypanosoma cruzi |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK |
| Application Notes: | Biological Origin: Trypanosoma cruzi. Application Notes: Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziKMP-11. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziKMP-11. |
Product Guarantee and Expert Support
