Bacteria tbp1 protein

Product Overview

• Article Name: Bacteria tbp1 protein
• Biozol Catalog Number: BYT-ORB605148
• Supplier Catalog Number: orb605148
• Alternative Catalog Number: BYT-ORB605148-20,BYT-ORB605148-100,BYT-ORB605148-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: tbp1, NMB0461, Transferrin-binding protein 1

Product Description

This Bacteria tbp1 protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 37.0 kDa
• UniProt: Q9K0U9
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Neisseria meningitidis serogroup B (strain MC58)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSKEQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAINEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALAGRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANP

Application Notes

• Application Notes: Biological Origin: Neisseria meningitidis serogroup B (strain MC58). Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup B (strain MC58) tbp1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Neisseria meningitidis serogroup B (strain MC58) tbp1.