Human CD22 protein

Product Overview

• Article Name: Human CD22 protein
• Biozol Catalog Number: BYT-ORB605196
• Supplier Catalog Number: orb605196
• Alternative Catalog Number: BYT-ORB605196-20,BYT-ORB605196-100,BYT-ORB605196-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: B-lymphocyte cell adhesion molecule (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD22)

Product Description

This Human CD22 protein spans the amino acid sequence from region 20-687aa. Purity: Greater than 94% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 77.9 kDa
• UniProt: P20273
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 94% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEY

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 µg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml. Application Notes: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 µg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml.