Mouse Cr2 protein

Catalog Number: BYT-ORB605207
Article Name: Mouse Cr2 protein
Biozol Catalog Number: BYT-ORB605207
Supplier Catalog Number: orb605207
Alternative Catalog Number: BYT-ORB605207-20,BYT-ORB605207-100,BYT-ORB605207-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Complement C3d receptor CD_antigen, CD21
This Mouse Cr2 protein spans the amino acid sequence from region 12-145aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.7 kDa
UniProt: P19070
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Cr2 was greater than 90% as determined by SEC-HPLC