Human MIF protein
Catalog Number:
BYT-ORB605235
- Images (4)
| Article Name: | Human MIF protein |
| Biozol Catalog Number: | BYT-ORB605235 |
| Supplier Catalog Number: | orb605235 |
| Alternative Catalog Number: | BYT-ORB605235-20,BYT-ORB605235-100,BYT-ORB605235-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | (MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase) |
| This Human MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 41.3 kDa |
| UniProt: | P14174 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 µg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml. Application Notes: Full Length of Mature Protein |




