Mouse Tnc protein

Catalog Number: BYT-ORB605277
Article Name: Mouse Tnc protein
Biozol Catalog Number: BYT-ORB605277
Supplier Catalog Number: orb605277
Alternative Catalog Number: BYT-ORB605277-20,BYT-ORB605277-100,BYT-ORB605277-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hexabrachion Tenascin-C Short name, TN-C Hxb
This Mouse Tnc protein spans the amino acid sequence from region 1884-2099aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 28.8 kDa
UniProt: Q80YX1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Tnc was greater than 95% as determined by SEC-HPLC