Human FGF2 protein

Product Overview

• Article Name: Human FGF2 protein
• Biozol Catalog Number: BYT-ORB605324
• Supplier Catalog Number: orb605324
• Alternative Catalog Number: BYT-ORB605324-20,BYT-ORB605324-100,BYT-ORB605324-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Basic fibroblast growth factor (bFGF) (Heparin-binding growth factor 2) (HBGF-2) (FGFB)

Product Description

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 17.9 kDa
• UniProt: P09038
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein

Images

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGF2.