Mouse MIF protein

Catalog Number: BYT-ORB605350
Article Name: Mouse MIF protein
Biozol Catalog Number: BYT-ORB605350
Supplier Catalog Number: orb605350
Alternative Catalog Number: BYT-ORB605350-20,BYT-ORB605350-100,BYT-ORB605350-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Delayed early response protein 6 (DER6) (Glycosylation-inhibiting factor) (GIF) (L-dopachrome isomerase) (L-dopachrome tautomerase (EC, 5.3.3.12)) (Phenylpyruvate tautomerase) (MIF)
This Mouse MIF protein spans the amino acid sequence from region 2-115aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 13.9 kDa
UniProt: P34884
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mif.
The purity of Mif was greater than 95% as determined by SEC-HPLC