Rat Prss2 protein

Catalog Number: BYT-ORB605373
Article Name: Rat Prss2 protein
Biozol Catalog Number: BYT-ORB605373
Supplier Catalog Number: orb605373
Alternative Catalog Number: BYT-ORB605373-20,BYT-ORB605373-100,BYT-ORB605373-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Anionic trypsin II (Pretrypsinogen II) (Serine protease 2) (Try2)
This Rat Prss2 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 25.3 kDa
UniProt: P00763
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Prss2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Prss2.