Mouse VWF protein

Product Overview

• Article Name: Mouse VWF protein
• Biozol Catalog Number: BYT-ORB605399
• Supplier Catalog Number: orb605399
• Alternative Catalog Number: BYT-ORB605399-20,BYT-ORB605399-100,BYT-ORB605399-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: von Willebrand antigen II (vWF)

Product Description

This Mouse VWF protein spans the amino acid sequence from region 1498-1665aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 22.3 kDa
• UniProt: Q8CIZ8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.The reducing (R) protein migrates as 28 kDa in SDS-PAGE may be due to glycosylation.Recommended Product

The purity of Vwf was greater than 90% as determined by SEC-HPLC