Virus VACWR156 protein

Product Overview

• Article Name: Virus VACWR156 protein
• Biozol Catalog Number: BYT-ORB605406
• Supplier Catalog Number: orb605406
• Alternative Catalog Number: BYT-ORB605406-20,BYT-ORB605406-100,BYT-ORB605406-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: VACWR156, A33RProtein A33

Product Description

This Virus VACWR156 protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 16.2 kDa
• UniProt: P68617
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Application Notes

• Application Notes: Biological Origin: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Application Notes: Partial

Images

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) VACWR156.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) VACWR156.