Plant Abrus precatorius Abrin-a protein
Catalog Number:
BYT-ORB605420
- Images (3)
| Article Name: | Plant Abrus precatorius Abrin-a protein |
| Biozol Catalog Number: | BYT-ORB605420 |
| Supplier Catalog Number: | orb605420 |
| Alternative Catalog Number: | BYT-ORB605420-20,BYT-ORB605420-100,BYT-ORB605420-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | rRNA N-glycosidase |
| This Plant Abrus precatorius Abrin-a protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 30.1 kDa |
| UniProt: | P11140 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Abrus precatorius (Indian licorice) (Glycine abrus) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN |
| Application Notes: | Biological Origin: Abrus precatorius (Indian licorice) (Glycine abrus). Application Notes: Partial |



