Bovine Odorant-binding protein protein

Product Overview

• Article Name: Bovine Odorant-binding protein protein
• Biozol Catalog Number: BYT-ORB605461
• Supplier Catalog Number: orb605461
• Alternative Catalog Number: BYT-ORB605461-20,BYT-ORB605461-100,BYT-ORB605461-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Olfactory mucosa pyrazine-binding protein

Product Description

This Bovine Odorant-binding protein protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 18.5 kDa
• UniProt: P07435
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Bos taurus (Bovine)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Application Notes

• Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine).

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Bos taurus (Bovine).