Bovine Odorant-binding protein protein
Catalog Number:
BYT-ORB605461
- Images (3)
| Article Name: | Bovine Odorant-binding protein protein |
| Biozol Catalog Number: | BYT-ORB605461 |
| Supplier Catalog Number: | orb605461 |
| Alternative Catalog Number: | BYT-ORB605461-20,BYT-ORB605461-100,BYT-ORB605461-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Olfactory mucosa pyrazine-binding protein |
| This Bovine Odorant-binding protein protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 18.5 kDa |
| UniProt: | P07435 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Bos taurus (Bovine) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE |
| Application Notes: | Biological Origin: Bos taurus (Bovine). Application Notes: Full Length |



