Plant UGT71C1 protein

Product Overview

• Article Name: Plant UGT71C1 protein
• Biozol Catalog Number: BYT-ORB605476
• Supplier Catalog Number: orb605476
• Alternative Catalog Number: BYT-ORB605476-20,BYT-ORB605476-100,BYT-ORB605476-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Flavonol 3-O-glucosyltransferase UGT71C1 (EC, 2.4.1.91) Flavonol 7-O-glucosyltransferase UGT71C1

Product Description

This Plant UGT71C1 protein spans the amino acid sequence from region 1-481aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 56.4 kDa
• UniProt: O82381
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Arabidopsis thaliana (Mouse-ear cress)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MGKQEDAELVIIPFPFSGHILATIELAKRLISQDNPRIHTITILYWGLPFIPQADTIAFLRSLVKNEPRIRLVTLPEVQDPPPMELFVEFAESYILEYVKKMVPIIREALSTLLSSRDESGSVRVAGLVLDFFCVPMIDVGNEFNLPSYIFLTCSAGFLGMMKYLPERHREIKSEFNRSFNEELNLIPGYVNSVPTKVLPSGLFMKETYEPWVELAERFPEAKGILVNSYTALEPNGFKYFDRCPDNYPTIYPIG

Application Notes

• Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) UGT71C1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Arabidopsis thaliana (Mouse-ear cress) UGT71C1.