Human SFTPA1 protein

Product Overview

• Article Name: Human SFTPA1 protein
• Biozol Catalog Number: BYT-ORB605515
• Supplier Catalog Number: orb605515
• Alternative Catalog Number: BYT-ORB605515-20,BYT-ORB605515-100,BYT-ORB605515-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 35 kDa pulmonary surfactant-associated protein Alveolar proteinosis protein Collectin-4 COLEC4, PSAP, SFTP1, SFTPA, SFTPA1B

Product Description

This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 26.2 kDa
• UniProt: Q8IWL2
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPA1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPA1.